Repressor involved in the biosynthesis of the osmoprotectant glycine betaine. It represses transcription of the choline transporter BetT and the genes of BetAB involved in the synthesis of glycine betaine (By similarity).

207 amino acids

MPKVGMEPIRRQQLIKATMAAIDEVGLAEATVMRIARHAGVSAGIISHYFGGKDGLLEATMRQILTDLSDAVAARRHALEDDSPRAHIGAIIEGNFDRTQVTGPAAKTWLAFWASSMHKPVLQRLQYVNDRRLYANLCHQFQRVMPKADARNAARGLAAMIDGLWLRGALTPEGLDAAEARYLAHTYLDQLLTHYGCYQDASTADFK

22.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make betI2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here