About Products Protein Database Contact

Protein expression services for arcR | HTH-type transcriptional regulator ArcR

Description
Positively regulates the expression of the arcABDCR operon under anaerobic conditions, thus playing an essential role in arginine catabolism. May also control the expression of genes encoding proteins which are involved in anaerobic metabolism. Can bind cyclic AMP (By similarity).
Species
Staphylococcus haemolyticus (strain JCSC1435)
Length
227 amino acids
Sequence
MAGKTYINNRDNDLSEGLKQLASYLNIPTGVIQAFKSECFVRRYNKGQIIYYSSDQPTYVYLLLDGIVLRETINEDGDAYRKLNKEQLLFPLNHLFRKIELNEMCTAITPCNVIGIPKDMLEYLCKNHDDIFVTLFEKLNNELELLMEYNMALTTKLARERIEKVLYYLCHAIGYDQDEFYEIKHIMTIQLLSDLAGISRETTGHIVHELKEEKKLIKNGKNWMVIK
Mass
26.5 kDa
Simulated SDS-PAGE
Western blot of arcR recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make arcR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here