Positively regulates the expression of the arcABDCR operon under anaerobic conditions, thus playing an essential role in arginine catabolism. May also control the expression of genes encoding proteins which are involved in anaerobic metabolism. Can bind cyclic AMP (By similarity).

228 amino acids

MTGNQMFCRENELDESFKQLASYINIPVGVLLPFKSQCFVRHYNKGQIVYYSSDETTHIYLLLKGNIMRENFNLNGDVYRYLNREKVLFPLNNLFQDKVPNEMCTALTDCEMIGIPRDLIEYLCKNHEEIFVKLFSLLSETQCQHIEYNMALTSKLAKERVTKILRYLCQTVGYDHDEFYEIKHFMTIQLLSDMAGISRETTSHIINELKEEKILFKNSKNWLVSKDL

26.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arcR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here