Protein expression services for dhaS | HTH-type dhaKLM operon transcriptional activator DhaS
Description
In complex with DhaQ, upon activation by dihydroxyacetone, activates transcription of the dhaKLM operon. Binds the inverted repeat sequence 5'-GGACACATN(6)ATTTGTCC-3' located upstream of and partially overlapping with the -35 promoter sequence of the dhaKLM operon promoter.
Species
Lactococcus lactis subsp. lactis (strain IL1403)
Length
187 amino acids
Sequence
MSAFFLNMKKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSDYYGWQNELLLLLRYLDENQIFYQKIFVIDKNFEHFFLIQWENLLDKVIFDQEKKSDYHWSDLEKSFICRYNAAAICAITRESIIRGNSLEKLYSQIVNLLLAQIKIFES
Mass
22.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make dhaS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here