May catalyze a purine salvage reaction, the substrate is unknown.

Belongs to the purine/pyrimidine phosphoribosyltransferase family. Archaeal HPRT subfamily.

182 amino acids

MEKLRESLHEAPIIDKDGYSYLVHPLSNGVPMLEPELLREVVVGVTRAADLDVDKIVAPEAMGIHIATALSLQTDIPLVVIRKRSYGLDDEVPLHKTTGYSESEMFINDIEAGDDLLIVDDLLSTGGTMAAICEALDDIGADISDIVVVFRKQGESALDDTDYDVTSLLDISVDQDGVTIHD

19.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rrnAC1903 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here