Required during prometaphase for centrosome maturation. Following poly-ADP-ribosylation (PARsylation) by TNKS, translocates from the Golgi apparatus to mitotic centrosomes and plays a key role in the formation of robust microtubules for prompt movement of chromosomes: anchors AKAP9/CG-NAP, a scaffold protein of the gamma-tubulin ring complex and promotes centrosome maturation (By similarity).

463 amino acids

MGQDAFMELLRSMVGLSLCKIHLLLIAGSCLGLKVTVPSYTVHGIRGQALYLPVHYGFHTPASDIQIIWLFERSHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFTDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVMKPMVQFHPASGAVEYVGNITLTCQVEGGTRLVYQWRKSGKPISINSSHSFSPQNNTLWIVPVTKEDIGNYTCLVSNPVSEMESDIIMPTIYYGPYGLQVNSDKGLKVGEVFTVDLGEAVLFDCSADSYPPNTYSWIQRSDNTTHVIKHGPHLEVASEKVAQKTADYVCCAYNNITGRRDETRFTVIITSVGLEKLAQRGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKAIRQKLEGRPESEYRKAQTFSGHEDALSDFGIYEFVTFPDASGVSRMSSRSSPASDGVTGQDIHGTIYEVIQHIPEQQQENTE

51.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Hepacam2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here