Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (By similarity). Required for normal chemotaxis in response to cAMP and for aggregation during scorocarp development.

Belongs to the WD repeat G protein beta family.

347 amino acids

MSSDISEKIQQARRDAESMKEQIRANRDVMNDTTLKTFTRDLPGLPKMEGKIKVRRNLKGHLAKIYAMHWAEDNVHLVSASQDGKLLVWDGLTTNKVHAIPLRSSWVMTCAYSPTANFVACGGLDNICSIYNLRSREQPIRVCRELNSHTGYLSCCRFLNDRQIVTSSGDMTCILWDVENGTKITEFSDHNGDVMSVSVSPDKNYFISGACDATAKLWDLRSGKCVQTFTGHEADINAVQYFPNGLSFGTGSDDASCRLFDIRADRELMQYTHDNILCGITSVGFSFSGRFLFAGYDDFTCNVWDTLKGERVLSLTGHGNRVSCLGVPTDGMALCTGSWDSLLKIWA

38.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gpbA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here