Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (PubMed:10192394). This specific G-alpha subunit plays an important role in olfaction and in cilia morphogenesis (PubMed:9459442, PubMed:15342507). Involved in chemotactic responses to attractants diacetyl, pyrazine, 2,4,5-trimethylthiazole, benzaldehyde, isoamyl alcohol, butanone and 2,3-pentanedione (PubMed:12694294). Displays a redundant function with gpa-3 in chemotactic responses (PubMed:12694294). Involved in avoidance responses to copper, sodium dodecyl sulfate and linoleic acid (PubMed:12694294). Involved in osmotic avoidance and mechanosensory responses (PubMed:12694294). Involved in specifying fan-like morphology of cilia of head sensory neurons AWC (PubMed:9459442). Plays a role in the detection of preferred food sources by mediating the recognition of food oders in olfactory sensory neurons (PubMed:25009271).

Belongs to the G-alpha family.

356 amino acids

MGSCQSNENSEGNARNKEIEKQLNADKRAGSSIVKLLLLGAGECGKSTVLKQMQILHSNGFTEEEVNEKRAIVYNNTVSAMCTILRAMDGVLHLPLENGQKEAEKAIVMKVQENGEEGEALTEEVSKAIQSLWADPGVKKAFEMRSEYQLPDSAKYFLDNCQRISEPGYRPNDQDILYSRVATTGVVEVKFKIKELDFRVFDVGGQRSERRKWIHCFDNVESIIFITAISEYDQVLFEDETTNRMIESMQLFNSICNSTWFLSTAMILFMNKKDLFMEKIQRVNITTAFPDYEGGQNYEEAVSFIKQKFAELNLNPDKKTIYMHETCATDTNQVQLVISSVIDTIIQKNLQKAGMM

40.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make odr-3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here