Description
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (PubMed:10192394). This specific G-alpha subunit plays an important role in olfaction and in cilia morphogenesis (PubMed:9459442, PubMed:15342507). Involved in chemotactic responses to attractants diacetyl, pyrazine, 2,4,5-trimethylthiazole, benzaldehyde, isoamyl alcohol, butanone and 2,3-pentanedione (PubMed:12694294). Displays a redundant function with gpa-3 in chemotactic responses (PubMed:12694294). Involved in avoidance responses to copper, sodium dodecyl sulfate and linoleic acid (PubMed:12694294). Involved in osmotic avoidance and mechanosensory responses (PubMed:12694294). Involved in specifying fan-like morphology of cilia of head sensory neurons AWC (PubMed:9459442). Plays a role in the detection of preferred food sources by mediating the recognition of food oders in olfactory sensory neurons (PubMed:25009271).
Sequence
MGSCQSNENSEGNARNKEIEKQLNADKRAGSSIVKLLLLGAGECGKSTVLKQMQILHSNGFTEEEVNEKRAIVYNNTVSAMCTILRAMDGVLHLPLENGQKEAEKAIVMKVQENGEEGEALTEEVSKAIQSLWADPGVKKAFEMRSEYQLPDSAKYFLDNCQRISEPGYRPNDQDILYSRVATTGVVEVKFKIKELDFRVFDVGGQRSERRKWIHCFDNVESIIFITAISEYDQVLFEDETTNRMIESMQLFNSICNSTWFLSTAMILFMNKKDLFMEKIQRVNITTAFPDYEGGQNYEEAVSFIKQKFAELNLNPDKKTIYMHETCATDTNQVQLVISSVIDTIIQKNLQKAGMM