Guanidinium ion exporter. Couples guanidinium export to the proton motive force, exchanging one guanidinium ion for two protons (PubMed:29507227). Overexpression leads to resistance to a subset of toxic quaternary ammonium compounds such as cetylpyridinium, cetyldimethylethyl ammonium and cetrimide cations (PubMed:11948170).

Belongs to the drug/metabolite transporter (DMT) superfamily. Small multidrug resistance (SMR) (TC 2.A.7.1) family. Gdx/SugE subfamily.

105 amino acids

MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYAVWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH

10.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gdx using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here