Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70 (By similarity).

Belongs to the GrpE family.

224 amino acids

MAARLLWAVRRRMQPLAAHAASEGRGWLHPFSTATQRTAGEDCNSEDPPDELGPSLAERALKLKAVKLEKEVQDLTVRYQRAVADSENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEETEPADQKLTLEKIFRGLSLLEAKLKSVFAKHGLEKMTPIGDKYDPHEHELICHVPAGVGVQPGTVAFVRQDGYKLHGRTIRLAQVEVAVESQRRL

25.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GRPEL2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here