Description
Zn(2+) acts as an agonist. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated mainly through G(q)-alpha and G(12)/G(13) proteins. Involved in regulation of body weight, gastrointestinal mobility, hormone secretion and cell death (By similarity).
Family
Belongs to the G-protein coupled receptor 1 family.
Sequence
MASPSRPGNDCSHVIDHSHVPEFEVATWIKITLILLFLVIFVVGILGNSVTIRVTQVLQKKGYLQKEVTDHMVSLACSDILVFLIGMPVEFYSIIWNPLTTPSYTVSCKLHSFLFETCSYATLLHVLTLSFERYIAICHPFRYKAMSGPCQVKLLIGFVWVTSTLVALPLLFAMGVEYPLVDVPSHRGLSCNRSRNHHSEHPETSNMSVCTNLSSRWTVFQSSIFGAFIIYLVVLVSVAFMCWSMMQALQRSKQGTLAAKGQQLQLRKSESEESRSARRQTIIFLRLIVVTLAICWMPNQIRRMMAAAKPKQDWTKAYFKAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRSVFAQVLRCRLTLPHANQDKRLRAQAASTMDSARSVHRPLIFLASRSNSSARRTDKVFLSTSQSESEAKPQSKPQLLNHESPESDSVMKPANPATENGIQEHEV
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service