Description
Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1, acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The GET complex cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER.
Family
Belongs to the GET2 family.
Species
Komagataella phaffii (strain GS115 / ATCC 20864)
Sequence
MSELTEAEKRQLLREKRKAKLSQGGGLDRLKKITGENNSKLSTDVPTKEPTADATTTATELPTQGLETRINAHDDPVSEIPDPLNEGFDGKEPDLDQLIASMFNKSAGHENPNSEEQGVPELMRRFSSILQGGDSGAAGLGAEAGGINPLDLLNSLGGSNIGKAQEEYGSTPEEIEFNKKSIAYKKHQNEVLKAKILVVRLVLILSLLFVYGRDFSLSLFTQTYAPNGSSFMRVFLTLELIFQTSLFFFISKNKNFTDDSLISKLLNIGGAFIPATYRNLLQTASKYQVLLSMFLFDLSIVVVVFAIRAAFNF
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service