Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1, acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The GET complex cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER.

Belongs to the GET2 family.

357 amino acids

MSETTDKQLTEAEKRKLLRERRLAKMAQGKASDRLNTILSQGSSVKSVSPPAVTSVLENKATKSTDTATVTDSSTNATSVSPSAAKATPTSTGVSSAISDFDDPEIQDISDVAVNNSGVLALGNLSGLDSNNPSQPNLDEMFQKIMQQQSQHNCDNDNNGENNPMAEMLKMFNSMGGGDNNGGLGGFDSMFSGSPNSPPPESISPEMMKYQADLAKYHTYQEQLWQFRFLVVRILATIFNFAYHFITIPSFTASNHAYVRDLSEVYPLLGFMTIFTSIEVVIIATYYLLFTKLGLFHASNQKSFILKGISTLSMFVPQLLRYEPLVATFLGYKELLGIFVGDLSLVVVMFGLLSFSN

39 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GET2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here