Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins.

Belongs to the glycosyltransferase 31 family. Beta3-Gal-T subfamily.

408 amino acids

MVIMKAGSSRCAFSLGFLVGSCSLYVFLRQVWFEESFSWQSNGRSSPSPPISHEQNSSNLTWRVEGSALINLKHPNQPGEDGHIADELFKKVRILCWVMTGPSNLQSKAQHVKNTWSRHCNVVLFMSSEEDRSFPTVGLGTGEGRDQLYWKTIRAFHYALKNHGHEADWFLKADDDTFVVVDNLRWILSNYTPEQPIYFGKRFKPYTKQGYMSGGAGYVLSKEALRRFVEGFSTKVCTHTTPVEDLAMGQCLEKMGVLAGDSRDSLHRETFHPFIPEHHLTGKFSKTFWYWNYCYYPIVEGPQCCSDLAVSFHYVDPVLMYTLEYYTYHLRPFGYQHRYQPPVPAVLSLLSQTVKTTTETQRSEEGAKEKPALTNSVNPRAEEVQTTETSYKITNAAQERNTTHRSAG

46.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make c1galt1a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here