Regulatory protein for the glycine cleavage system operon (gcv). Mediates activation of gcv by glycine and repression by purines. GcvA is negatively autoregulated. Binds to three sites upstream of the gcv promoter (By similarity).

Belongs to the LysR transcriptional regulatory family.

305 amino acids

MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYFLDIKEIFSQLTEATRKLQARSAKGALTVSLLPSFAIHWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGEKPLKTPEDLAKHTLLHDASRRDWQTYTRQLGLNHINVQQGPIFSHSAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKIAAFRQWILAKAAAEQEKFRFRYEQ

34.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gcvA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here