Not known, the gcv operon regulated by the E.coli homolog does not exist in H.influenzae, so it probably acts as a transcriptional regulator on some other operon.

Belongs to the LysR transcriptional regulatory family.

301 amino acids

MEILMYKRLPPLNSLKSFESAARYLSFTKAADELCVTQAAVSHQIKLLEXFLGIDLFKRKNRSLELTELGKAYFVDINKILRRLNEATERLLTLKTDPHLNISVPQTFGIQWLVPHLSEFNQLYPQIEVRLTGVDQDEGLLNKEIDLAIYYGLGNWQNLQVDRLCEENLLILASPELLAENPIIQPEDLKKHTLIHIHTCDNWQAMANHLQLDDLNIQQGPLFSHTFMALQAAIHGQGIVLANRLLALQEIENGSLQAVLPTNLPDPKSFYVVNHLDRLDDQKIQAFRQWIINSIKQEENE

34.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gcvA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here