Part of the OusB ABC transporter complex involved in glycine betaine and choline uptake. May also transport several other osmoprotectants such as ectoine, DMSA, DMSP, proline and carnitine. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family.

406 amino acids

MTDTTQNPWEEDQAPDQAAAANHSHAAATSGEHAAAAGSSGTPAQTDPWAASSSAPAGNTPAPDNAADAWSNAPPPAASDVHQSAADWLNSTPTPTQEHFNLMDPFRHTLVPLDRWVTEGIDWLVLHFRPLFQGIRVPVDMILTSFQQLLTGLPAPVAILVFSLLAWQVSSFGMGVATLLSLVAIGAIGAWSQAMVTLALVLTALFFCVIIGLPLGIWLAHSDRAARIVRPLLDAMQTTPAFVYLIPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQVPADLVEAAQSFGASPRQMLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLASIGGVGIVILAIILDRLTQSLGRDARSRGNRHWYHHGPLGLLARPFIKSRA

43.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ousW using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here