Methyltransferase able to methylate free cob(I)alamin in vitro, using glycine betaine as the methyl donor, yealding methylcobalamin (methylCbl) and dimethylglycine. In vivo, probably carries out the methylation of a corrinoid protein, likely the adjacently encoded DSY3155, with glycine betaine, to then supply methyl groups to tetrahydrofolate (THF) for ultimate conversion to carbon dioxide; oxidation of the methyl group would also provide reducing equivalents for anaerobic respiration. Thus, may function in the pathway that allows anaerobic methylotrophic growth of D.hafniense using glycine betaine. Cannot use quaternary amines such as carnitine and choline as substrates, nor tertiary amines such as dimethylglycine or trimethylamine.

Belongs to the trimethylamine methyltransferase family.

479 amino acids

MGQLLPKYNILTEDQVQKIHENTMKILEEIGIEFEYEPALEVFRREGQKVEGKRVYLTREFVESKLKSAPAEFTLHARNPENNVVIGGDNIVFMPGYGAPFIYELDGSRRKTTLQDYENFAKLAGASKNMHLSGGTMAEPQDIPDGVRHLQMLYSSIKNSDKCFMGSAEGKERAEDSVEIAAILFGGKDVIKEKPVLVSLINSLTPLKYDERMLGALMAYAEAGQAVIIASLVMAGSTGPASLAGTLSLQNAEVLAGISLAQSINPGTPVIYGSTSALSDMRSGSLSIGSPECALFISASAQLARFYGVPSRSGGGLNDSKTVDAQAGYESMMTLMAANLTGVNFVLHTAGILQYFMAMSYEKFIMDDEIAGMLLHYMKGYTFDEDGMAFDVIEKVGPGGHFLTQKHTRKNHKREFYTPTLSDRSAYDTWAKEKLETKQRAHARWQQILANYVPPALDPEIDAKLQAFIAQRGKEVGEE

52.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mtgB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here