Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP.

Belongs to the PlsY family.

216 amino acids

MNFPIFALFSFVSGSIPFGYWIALRFAGVDIRKLGSKNIGATNVGRLIGWKFGFIVLALDITKGMLPVYLSSVYVPEGGIPFQLLCGVCAVLGHMFSPFLGFRGGKGVATTFGVFLVLTPIACLGAVLVFWVVYKFFKFVSLGSIFASITLPLVYAFSTILLLHEEVSYWVLGTMVFISFGIILTHRENIIRILNRSELFAVKGEEQDGDSERNRR

23.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make plsY using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here