Protein expression services for agmR | Glycerol metabolism activator
Description
Positive activator for glycerol metabolism. Regulates the expression of qedA in a positive manner and governs the expression of ADH I and ADH IIB. General regulator of quinoprotein ethanol oxidation and affects expression of ADH IIG activity but is not the sole regulator.
Species
Pseudomonas putida
Length
221 amino acids
Sequence
MYKILIADDHPLFREAIHNVITDGFPGSEVMETADLDSALSLTGQHDDLDLILLDLNMPGMHGLGGLINLRNEAPTIPVVIVSAEQDKQVVLQAITYGAVGFITKSSPRSQMTDAIEQILNGNVYLPPDIIRTQKSTGRRNQSEHAGFAPELLQALTRKQLLVLERMTKGESNKQIAYNLDIAETTVKAHVSAILRKLNVHNRVQAILSAGDIDFTAYLRR
Mass
24.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make agmR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here