Catalyzes the oxidation of glycerol to glycerone. Also acts, more slowly, on a number of other polyols including D-sorbitol, D-arabinitol, D-mannitol, meso-erythritol, adonitol and propylene glycol (By similarity).

126 amino acids

MPNTYGSRTLTEWLTLVLGVVIILVGLFFVIAGADLAMLGGSVYYVICGIPLVAGGVFMLMGRTLGAFLYLGALAYTWVWSLWEVGFSPVDLLPRDFGPTLLGILVALTIPVLRRMETRRTLRGTV

13.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sldB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here