Maintains high levels of reduced glutathione in the cytosol.

Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.

470 amino acids

MASIPHYDYLVIGGGSGGVASARRAASYGAKTLLIEGKALGGTCVNVGCVPKKVMWNASDLAGRIRQAKEYGFPDVDPKYADNFDWSGFKAKRDAYVKRLNGIYERNLQKEGVEYVFGWATLYKQEGQEFPLVHVKSDDGNTKLYSAKKIMIATGGKPRLPDVPGAEYGIDSDGFFALETQPKRVAVVGGGYIGVELAGVFHGLNSETTLFCRGQTVLRAFDIMIQDTITDYYVKEGINVLKGSGVKKIVKKDNGELLVTYEQDGAEKDITLDSLIWTIGREPLKDTLNLGEFGIKTNKRGYIEVDEYQRSSVDNIYSLGDVCGKVELTPMAIAAGRKLSNRLFGPTEFKNQKQDYTDVPSAVFSHPEVGSIGITEAAAKEQYGEENVKVYTSKFVAMYYAMLEEKAPTAYKLVCAGKDEKVVGLHIVGADSAEILQGFGVAIRMGATKADFDNVVAIHPTSAEELVTMR

51.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GLR1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here