Glutathione S-transferase-like protein; part of the gene cluster that mediates the biosynthesis of the bibenzoquinone oosporein, a metabolite required for fungal virulence that acts by evading host immunity to facilitate fungal multiplication in insects (PubMed:26305932). The non-reducing polyketide synthase OpS1 produces orsellinic acid by condensing acetyl-CoA with 3 malonyl-CoA units (PubMed:26305932). Orsellinic acid is then hydroxylated to benzenetriol by the hydroxylase OpS4 (PubMed:26305932). The intermediate is oxidized either nonenzymatically to 5,5'-dideoxy-oosporein or enzymatically to benzenetetrol by the oxidoreductase OpS7 (PubMed:26305932). The latter is further dimerized to oosporein by the catalase OpS5 (PubMed:26305932). OpS6 probably functions en route for protecting cells against oxidative stress by scavenging any leaked free radical form of benzenetetrol by activating the thiol group of glutathione (PubMed:26305932).

Belongs to the GST superfamily.

218 amino acids

MASLQPIKLYAHKKGPNPWKVALILEELGLPYETTYLEFPDAKVEPYISLNPNGKLPAIQDPNHSIELFESGAIIEYLIEQYDKDGKLSHESLQDKSLARAWLHLQMSAQAPVIGYKVWMGRTYDASQIVSANEFLTLEIKRVLGVLDKHLAKMGGPYLLGSKVSYADLAFVPHYMMLPLFVPDYDPATEYPHFAAWLAALKERPAVKKIAATKAALA

24.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OpS6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here