Protein expression services for FUS3 | Glutathione S-transferase-like protein FUS3
Description
Glutathione S-transferase-like protein; part of the gene cluster that mediates the biosynthesis of the mycotoxin fusarin C (PubMed:22652150). Within the cluster, FUS1, FUS2, FUS8 and FUS9 are sufficient for fusarin production (By similarity). The other FUS cluster members are not essential for fusarin C biosynthesis (By similarity).
Family
Belongs to the GST superfamily.
Species
Gibberella moniliformis (strain M3125 / FGSC 7600)
Length
220 amino acids
Sequence
MTSFGTLYTYMPNARVFKILAAAKLNNLIIEIPAYQHGVTNKSAEFLSKFPAGKVPAFEGPDGFCLVESDAIAQYVAQSGPQASQLLGQDAMSSAKIRQWISFFAEEIYPTVLDLVMWRVGLGAFDETTEIKALAQLAYGLSVLEKHLNPGILLTGDELTLADLTGASTLLWAFMHIIDEPMRQQYPNVVAWYLKVVQNEEVKEVFGKPNLIEKRRIGAK
Mass
24.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make FUS3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here