Involved in the transport and/or accumulation of both anthocyanins and proanthocyanidins (PA)s in the vacuole. Functions in the cytosol to maintain the regular accumulation in the vacuole of PA precursors, such as epicatechin and glycosylated epicatechin.

Belongs to the GST superfamily. Phi family.

214 amino acids

MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLIIKPRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKARGSFNRWWEEISDRPSWKKLMVLAGH

24.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GSTF12 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here