About Products Protein Database Contact

Protein expression services for Glrx5 | Glutaredoxin-related protein 5, mitochondrial

Description
Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (By similarity). Required for normal iron homeostasis (By similarity). Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (By similarity). May protect cells against apoptosis due to reactive oxygen species and oxidative stress (PubMed:19442627).
Family
Belongs to the glutaredoxin family. Monothiol subfamily.
Species
Mus musculus
Length
152 amino acids
Sequence
MSASLSRAAAALLRWGRSAGGGGLPGAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK
Mass
16.3 kDa
Simulated SDS-PAGE
Western blot of Glrx5 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Glrx5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here