Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). Required for proper protein synthesis within the mitochondrion.

Belongs to the GatF family.

167 amino acids

MKAILRSSTRNLITSSRVFKNLRTSEEIRSFLAESTWSISELLQPPTGSSQTEVSPEIVKKMLKLSGLNDLKHDKSVTKALNLQMMLINHLYDNEQDTVTPSRERNDNNGIFRLLASDHLPQQPWDLDDLLKQINELKPDPSKGEVDFTISDLQRDSFVIKKEKNVK

19.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GTF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here