About Products Protein Database Contact

Protein expression services for gatD | Glutamyl-tRNA(Gln) amidotransferase subunit D

Description
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). The GatDE system is specific for glutamate and does not act on aspartate.
Family
Belongs to the asparaginase 1 family. GatD subfamily.
Species
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Length
427 amino acids
Sequence
MEVRRGDGSVFRGVLMPKHETSHPDTVVIKLGNGYNIGVLVGEGDDIVVKGSLRPGTPGALVPLLEEPLQPAEERVYIIGAGGTIASRVDYETGAVKPYLDASELATTIPELQRYASIEAEQLFSILSEDMKPSMWEAIVDRAARVLEAGYDGVVVAHGTDTMAFTASALSFAFHKGLPSPVILTGSQRSSDRPSSDAAFNLTASVLAASRAPFAEVAVVMHGETGDTYALAHRGVRVKKMHSSRRDAFQSVNDKPLARIYPFEGRVEMLRDDYRRRGESGLEVDNGFEERVALVKHFPGLISEVIDALLDRGFKGIVVEGTGFGHVSSDAIKSIERARDQGVPIVITTQTVFGRVNLNVYSTGRKMLAAGAIPAGDMTSEAAYAKLSWILARTRELEVVRKMFQRNLAGEVSERHILRLYRHIGGV
Mass
46.4 kDa
Simulated SDS-PAGE
Western blot of gatD recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make gatD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here