Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the amidase family. GatA subfamily.

478 amino acids

MEILDMTVEQLRNAILDKHLKSEDIVKAYFDNIKRNEPEINAYITLCEDYALKEAKDVDKKIANGDKVGRLAGIPIAIKDNICTDGIKTTCASKMLYDFVPPYDATVIKKLKAEDAIIIGKVNMDEFAMGSSTENSAFKITKNPRDITRVPGGSSGGSAAVVAAKMAPISLGSDTGGSIRQPAAFCGVVGLKPTYGLVSRFGLIAFASSLDQIGPLGKTVKDCAELLEVISGEDELDNTSSKKHEKEDYLEGIDDGIKGMKIGMPKEFLNDGLDPEIRKCIDDTIEKLKSLGAEVCEMSLPITEEGLSAYYIISSAEASSNLARFDGIRYGYRPDDFEDVYDLMETSRSEAFGDEVKRRIMLGTYALSSGYYDAYYKRALKLKKKIKNEFKEAFENYDLILSPVSPVLPFKIGEKKADPLQMYLADIYTVNINLAGIPAISLPCSVSKEGLPIGLQLLGPHFGEKKIFRAARALEKER

52.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gatA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here