Protein expression services for GLUTRBP | Glutamyl-tRNA reductase-binding protein, chloroplastic
Description
Involved in the regulation of glutamyl-tRNA reductase (GluTR) which is important for the synthesis and distribution of 5-aminolevulinate, a precursor in heme and chlorophyll biosynthesis (PubMed:22180625). Stimulates GluTR activity and regulates glutamate-1-semialdehyde release. May play a role in heme metabolism (PubMed:24753615). Necessary for efficient photosynthetic electron transport in chloroplasts (PubMed:20657737).
Species
Arabidopsis thaliana
Length
317 amino acids
Sequence
MQLQTQSFALNLLPSPNFAKPIERREFISLKRDPSRPISLRCSVSTTLDTPATASTHKPFPAEVSRSIMELSSVGTLSTLTHDGWPLGVGVRFAVDKDGTPVLCLNRSVSPDKRSALHVQLEQCGLRTPQCTIQGSIGRPGDDTVLKRLSATWREKFGEEVKEDSLYVVAVDRVLQMEDFMEDGIWVASSDYKNASPDPLRDIAEDIVNQINANNMEDIFRFCNVYVDLDFVVSETKMIWMDRLGFDLRVWSPRGVYDVRIPFPMEVTDEKGAKSSFNGMSQLAWEVEKSYCPADFNKVKLLKQVVGSSHSHKGGGQ
Mass
35.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GLUTRBP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here