Catalyzes the tRNA-independent activation of glutamate in presence of ATP and the subsequent transfer of glutamate onto a tRNA(Asp). Glutamate is transferred on the 2-amino-5-(4,5-dihydroxy-2-cyclopenten-1-yl) moiety of the queuosine in the wobble position of the QUC anticodon.

Belongs to the class-I aminoacyl-tRNA synthetase family. GluQ subfamily.

293 amino acids

MIPPSYIGRFAPSPSGSLHFGSLVAALGSYLRAHSQQGQWLVRIEDIDPPREVPGASDNILRTLDAYGLHWHGTVLFQQQRYQVYQDQIEAFIASDLAYYCQCTRKIIQTSGGVYDGRCGRLQPRLTHGAIRIRNHVKVDHFVDKLQGPVVVDKAFAEEDFIIKRSDGLYAYQLAVVLDDAYQGITEVVRGCDLLEASCRQISLFTQLEFTPPDWLHLPLVCAEKGFKLSKQNYAPAIDVIHPQASINAALTFLGQKAVDVDSVEVMLKQAVEQFDLSTIPAQKEIVLSTIND

32.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gluQ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here