Required for polymorphic O-glycosylation of the serine-rich repeat protein PsrP. Catalyzes the second step in glycosylation of the serine-rich repeat protein in this bacteria. Transfers glucose from UDP-glucose to the terminal GlcNAc moiety of 3-O-(N-acetyl-alpha-D-glucosaminyl)-L-seryl-[protein] which results from the first glycosylation step of PsrP (using the short substrate SRR1-GlcNAc) (PubMed:28246170, PubMed:25404702, PubMed:21653318). Has weak hydrolytic activity against UDP-glucose and even weaker activity on UDP-galactose (PubMed:28246170). Does not complement deletion of the gtf3 gene from S.parasanguinis strain FW213 (PubMed:21653318).

Belongs to the Gtf3 glucosyltransferase family.

336 amino acids

MKLHLTNLYGMAGDSTVILAQNAVQKIASQLGFREVGIYFYNIASDSPSEMNKRLDGIMASISIGDILVFQSPTWNGFEFDRLLFDKLKDMQVKIICFIHDVVPLMFDSNYYLMKDYLYMYNLSDVLIVPSERMKTRLMEEGLTTKKILVQGMWDHPHDLSLYTPAFKKELFFAGSLERFPDLQNWSQDTPLRVFSNKGEASSSARSLSIEGWKKDEELLLELSKGGFGLVWGTHQNEGESNQYYTLNISHKVSTYLTAGIPVIVPSSLSTAKFIVDQGLGFMADSLEEVHEIVDKMNLQEYQEMTNRIKTFSYLLKEGYFTKKLLVDAIYHLGID

38.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gtf3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here