Involved in the biosynthesis of the compatible solute mannosylglucosylglycerate through a phosphorylating pathway. Catalyzes the transfer of a glucose (Glc) moiety from uridine diphosphate (UDP-Glc) to the position 2 of 3-phospho-D-glycerate (3-PGA) to form glucosyl-3-phosphoglycerate (GPG). UDP-glucose is the preferred substrate, but it can be partially replaced by ADP-glucose.

Belongs to the glycosyltransferase 2 family.

325 amino acids

MKDNILKRSFHHSKFENIKELVKLKEKQDVKISLAFPSLNEEKTIGKEIIIMKSELMEKYPLLDEIAVIDSGSEDETVSIAKEYGAKVFYSSDILPEYGFYKGKGENLWKSLYALDGDIIVWVDSDIENIHPKFVYGLVGALLNYPEIGYVKAFYDRPIVGKSAMQPTGGGRVTELVARPLFSLFYPELSTIIQPLSGEYAGRREILEKLPFFVGYGVEIAHLIDIAEKFGSEIIAQVDLELRIHDNQPLHSLSKMAFELTKVVLKRLEKYGKLDLNTELTDKHIMIQKKENEKVLVPTEILSVERPPMITIPEYKEKFSKEEKV

37.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gpgS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here