Part of the ABC transporter complex GlcSTUV involved in glucose uptake (Probable). Binds glucose. Can also bind galactose and mannose (PubMed:10400586, PubMed:11260467).

Belongs to the bacterial solute-binding protein 1 family.

554 amino acids

MKRKYPYSLAKGLTSTQIAVIVAVIVIVIIIGVVAGFVLTKGPSTTAVTTTVTSTFTTTTTIPSTTTSTPSNTVVFYTWWGGGDGGEALSQIIPAVKQYAGLQMQTYSIPGAGGTNAKYAILALIQAGKPPAAFQVHYGPEMISYVEAAPNGIHTFVNMTPYLIQWGLLNNAVYAVLQAGAYNGTLLSVPINVHRGAVLYVNTQLLREYNLPFPYNFSTLVYDTVQLANHGVSPWIIPGGDGGWDQFNVWEDIFLYLAGPQLYNELIYGTLNFSNPTVQKLINETNYWFLNFTSYNYPGWQSMSWEQAFALIAQGKVAFQANGNWVTNYASYINVTVYPPLPQYISNSSVSVVETPFPGTQHYYALVIDTIGIPVGPQEQQALQLAHFWSSYQGQEVWTKYKAVTYYKNGTDWYAQPAQWYDYQQLINTSEQNFVYQLSDGGVFDDVFAQIDSGLLTLQQVGKVGLSAWNSTLVSSMQQEQNEWLAAAKLGLGYLGFPGHPFAGYYPPWVTNPSAYGLTNNTQKTSNSVMLFLLPFLALPLAIASIDNKYYLLK

61.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glcS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here