About Products Protein Database Contact

Protein expression services for gdh | Glucose 1-dehydrogenase

Description
Catalyzes the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. To a lesser extent, is also active with xylose as substrate, but mannose, arabinose, galactose, fructose 6-phosphate, glucose 6-phosphate, glycerinaldehyde 3-phosphate, ribose, sorbitol, ethanol, erythritol, or lactose are not oxidized by the enzyme. Can utilize both NAD(+) and NADP(+) as electron acceptor, with a marked preference for NADP(+). Is involved in the degradation of glucose through a non-phosphorylative variant of the Entner-Doudoroff pathway.
Family
Belongs to the zinc-containing alcohol dehydrogenase family. Glucose 1-dehydrogenase subfamily.
Species
Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1)
Length
347 amino acids
Sequence
MRAVTVTPGVPESLRLREVPEPKPGPGQVLLKPLLVGVCGTDKEIIEGRYGKAPEGSDYLILGHEALAEVAALGKGVDNVSEGDLVVPTVRRPLDCQLPVDYCPPGKYLEHGIWGLHGHAAELSITDAAYLVKVPKELRDIAVLTEPLSVVEKGVELGVESYKARLGSPPKTALVLGAGPVGLLASMVLRLMGVSITAVATRPHDSLKARLVEELGGRYIDAVHERLEGEFDLVIEATGAPSLAVQGLERLAPGGVEVLLGVYPPTGELKGLGSLLTDAVLKNKLVVGSVNAGLRHFERALAHLKEANDSLNGFPKRLITKVVPLERYQEAYVWTHDDIKVVLQVQT
Mass
37.1 kDa
Simulated SDS-PAGE
Western blot of gdh recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make gdh using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here