Catalyzes the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. Can utilize both NAD(+) and NADP(+) as electron acceptor. Is involved in the degradation of glucose through a non-phosphorylative variant of the Entner-Doudoroff pathway.

Belongs to the zinc-containing alcohol dehydrogenase family. Glucose 1-dehydrogenase subfamily.

349 amino acids

MKAVTVIPSVPESLRLRDVDKPKPNHGQVLLKPIRVGICGTDKEIIEGKYGKAPPGSQYLILGHEALAVVEELGDGVDNVAVGDVVVPTVRRPLDCNLPVDYCPMGHYVEHGIWGLHGHAAEYSVTDAKYLVKVPKELIDVAVLTEPLSVVEKGIDVALSVGGSRFEWRPRSALILGAGPIGLLSTMVLRLMGLLTTTVATRPPDSLKARLVRELGGVYVDSALSSIEGVFDLVVEATGSPQVMVDGLRHLAPNGVMVLLGVYPPGGVINDLGNVLTDSVLNNKVLVGSVNAGVKHFELGLRHMAEAKGRFGDWLSRLITKRATLDNYQEAYSWTHDDIKTVLEINPLN

37.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gdh1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here