Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. EXG2 is not heavily involved in the exoglucanase function of the adhesion process.

Belongs to the glycosyl hydrolase 5 (cellulase A) family.

479 amino acids

MMLFLIHLMALCCMFVAEVACEQFNSTSNSSSAQSSLIDFQYKGVSIGGWLVLEPYITPSLFNATLSSGETWTDLPVDEYHFCEKLGAKEAEKRLTDHWESMYNETDFKQIKEAGLNMVRIPIGYWSFEKLEGDPYVSGAQDYLDKAIEWSHANDLKVMIDLHGAPNTQNGFDNSGLRNLGYPGWQNKTEYVNHTYKVLQQMFQKYGTGKYASDYKNTIIGIEVLNEPLNPNMDKLKEFYIESYNDGREIQVINNTIFFQEAFQPIGYWDSFLEKGEIKVTETSNGTNHTTTKKADFKNIIIDHHHYEVFTESQVASNVSTHLENIKNYASAIGKEKAKAIVGEWSAALTDCAPWLNGVGLGSRYEGTAPYTNDRVGSCAEFNKSPDKWSKKQKKDYRRFVEMQLYEYSTNSQGWIFWCWKTEGATEWDFRALVKNGIMPQPLDNYKYVKNGTDTSSASAIASNKMTLLLAFLLVILVI

54.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EXG2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here