Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis.

Belongs to the glucagon family.

single

78 amino acids

HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGITXXXXXXXXHADGTYTSDVSSYLQDQAAKKFVTWLKQGQDRRE

9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gcg using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here