GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis.

Belongs to the glucagon family.

206 amino acids

MKMKSIYFIAGLLLMIVQGSWQNPLQDTEEKSRSFKASQSEPLDESRQLNEVKRHSQGTFTSDYSKYLDSRRAQDFVQWLMSTKRNGQQGQEDKENDKFPDQLSSNAISKRHSEFERHAEGTYTSDITSYLEGQAAKEFIAWLVNGRGRRDFPEKALMAEEMGRRHADGTFTSDINKILDDMAAKEFLKWLINTKVTQRDLLGEYQ

23.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GCG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here