Regulatory component of cullin-RING-based SCF (SKP1-Cullin-F-box protein) E3 ubiquitin-protein ligase complexes. Inhibits E3 ubiquitin ligase activity by binding to the RING domain of RBX1 and inhibiting its interaction with the E2 ubiquitin-conjugating enzyme CDC34. Inhibits RBX1-mediated neddylation of CUL1 (By similarity). Required for normal stability and normal cellular levels of key components of SCF ubiquitin ligase complexes, including FBXW7, RBX1, CUL1, CUL2, CUL3, CUL4A, and thereby contributes to the regulation of CCNE1 and MYC levels (PubMed:22405651). Essential for normal development of the vasculature (PubMed:22405651). Contributes to the regulation of RPS6KB1 phosphorylation (By similarity).

596 amino acids

MAVEELQSIIKRCQILEEHDFKEEDFGLFQLAGQRCIEDGYINQLLEIIQDEKNKTIIKSMGWNLVGPVVRCLLRGREEDKREECFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQIILLLLQPLQTVIQKLPNNKAYSVGLALSTLWSQLSLLPVPHSEEQIQADDYGLCQCCKALIEFTKPFVEEVISDKENKENAKLKDELLKFCFKGLKCPLLTAQFLEQSEDVGNDPFRCFASEIIGFLSKIGHPVPQIILNHGRKKRTWDYLEFEEEEDKQLAESVASLTYLVFVQGIGIDQLPMVLSPSYLLQLNMEHIEVFLQRTEQSIYSKGLELLETSLLRLEDNSLCYQYLEIKSFLAVPQGLVKVMTLCPIETLRKKGLSMLQLFIDKLDSQGKYTLFRCLLNTSNHSGVEAFVIQNIKNQIDLSFKKTYNKWFAGAQLISLLDLVLSLPEGAETDLLQNSDRIMASLNLLRYLVIKDNEDDNQTGLWTELGKIENNFLKPLHIGLNMSKAHYEAEIKNSQQNNQVASMCKGVCSVTVGGEEIPSMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKSKSTSEENVGIK

67.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Glmn using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here