Probably interacts with GlcNAc residues. May promote attachment to both epithelial cell surfaces and chitin. This function enhances bacterial colonization in the gastrointestinal tract and may also be important in the environment by augment colonization of chitinous structures, leading to improved survival. Promotes bacterial attachment to, and colonization of, zooplankton in the aquatic ecosystem.

Belongs to the GbpA family.

485 amino acids

MKKQPKMTAIALILSGISGLAYGHGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDGNGPVLPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVEPQTPPTPGDYDFVFPNGLKEYVAGTKVLASDGAIYQCKPWPYSGYCQQWTSNATQYQPGTGSHWEMAWDKR

53.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gbpA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here