About Products Protein Database Contact

Protein expression services for Gcsam | Germinal center-associated signaling and motility protein

Description
Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.
Species
Mus musculus
Length
181 amino acids
Sequence
MGNCLQRTTRWQLDMQETPWNLRLSAKGRTCRYFRGWSCCHSVEGCSCLPWKNIRTFKARQESPKQNEGMTSAPVQDNANETYTEELCYILVDHEAVRGRPSVNPAEGFYENISNKAERHKESSRGTETEYSVLRFPSPPQPLPSTDDEYELLMPSRFSSHAFQQPRPLTTPYETHFSYPQ
Mass
21 kDa
Simulated SDS-PAGE
Western blot of Gcsam recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Gcsam using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here