Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P). This reaction is the first ether-bond-formation step in the biosynthesis of archaeal membrane lipids.

Belongs to the GGGP/HepGP synthase family. Group II subfamily.

244 amino acids

MSLEERMRKAERTLLAVLLDPAKLDDEGARKLARAASEGGADLIFVGGSIGAGFRINEIILSVKKESNIPIILFPGNVDGVSPYADAILFMSLLNSTNPYWIIQAQALAAIPIRRMGLEAIPTAYLIVEPGQRSAAGWVGSVNPIPRDKPEIALAYATAAEMLGMRWIYLEAGSGAEAPVPSEMVRLVRERTNLGIIVGGGLRSPELVRERAEAGANVIVVGTHIEEGRDALASVREMKEALKS

26.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Kcr_1391 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here