Essential for respiratory growth and required for maintenance of mtDNA. Required for cell survival in the absence of prohibitins (By similarity).

Belongs to the GEP5 family.

267 amino acids

MNMAVRALEKLPLDIRTLELLERKLLKKSLPGFQELAQQYTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIEQHPVLGLEIKESKLLKRL

31.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GEP5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here