TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).

Belongs to the TFIIF beta subunit family.

277 amino acids

MSKEDKEKTQIIDKDLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKLRINKTPGQKAQVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSHMAPSDGKENSTTSAAQPDNEKLYMEGRIVQKLECRPIADNCYMKLKLESIRKASEPQRRVQPIDKIVQNFKPVKDHAHNIEYRERKKAEGKKARDDKNAVMDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKNPHKNMWELKKEYRHYKTEEKKEEEHKSGSSDSE

32.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TfIIFbeta using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here