Present in the aqueous fluid surrounding olfactory sensory dendrites and are thought to aid in the capture and transport of hydrophobic odorants into and through this fluid.

Belongs to the PBP/GOBP family.

142 amino acids

MKVFVAICVLIGLASADYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCLLKENLAQIQKSLAPKA

16 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Obp99a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here