Regulator of DNA replication. Promotes initiation of chromosomal DNA replication by mediating TOPBP1- and CDK2-dependent recruitment of CDC45L onto replication origins (By similarity).

Belongs to the GEMC1 family.

333 amino acids

MNSILPCQDQYFVGGQSYNCPYSTTTSESGVDVSKETWVSFWAAGLLDNTELQQAPQVLESPSELSFPVLDSCSWEEAQLSSQLYRNKQLQDTLLQKEEELARLHEENNHLRQYLNSTLVKRLEEKAKKLLSSDEFSKVFGKLRKEKRKPKEHRHSPAEIPQFKTAKRNLSTEFSNCEEQPGPHVDPWVLQTLGLKDLNTIDDTLPANYSATTSHPRAVPSISSLFVHDANGYANVPRDLHLDYVGQGTHGSHTTSIHQEDCHSFPRLSNPPVRVQTLPYHTADVSPNKTEMAFSTSLSPHCNVKTHSFHQGQAFVRRDEEGGWKFTWVPKQT

37.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Gmnc using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here