About Products Protein Database Contact

Protein expression services for GEMIN7 | Gem-associated protein 7

Description
The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus (By similarity).
Family
Belongs to the gemin-7 family.
Species
Bos taurus
Length
125 amino acids
Sequence
MQTPLATPVPVLRLPRGPDGSNRGFAPDGRRAPPKPEVPEPPESRESWEQQARASLRERYLRSLLAMVGRPVCFTLHEGVQVIAHFGATDLDVANFYVSQLQTPIGIQAEALLRCSDIISYTFKP
Mass
13.9 kDa
Simulated SDS-PAGE
Western blot of GEMIN7 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GEMIN7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here