Early protein responsible for decreasing host DNA gyrase activity. Promotes DNA relaxation of bacterial host genome. Modulates the expression of various host genes probably controlled by supercoiling of their promoters. Host genes affected include DNA replication and cell division determinants (By similarity).

Belongs to the mulikevirus gemA protein family.

183 amino acids

MSRTSLIKLIHVARRELQLDDDTYRAFLMQKTGKISCRELTVTQLEQVLDAMKERGFKKLNKYPRRRFKEHVTPREKVYKIWQQMAEDGFITDGGDVALDKYVQRLTAKRNGGQGVSTLAWCHGESLQVVLETLKQWHIRCIREAFSRHGLPLPVSPSGRELRGYDAMTAAYAHARKTRRMAQ

21.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gemA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here