Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes. Stimulates gastric acid and pepsinogen secretion (By similarity).

Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

128 amino acids

MAFTGKYETESEKNYDEFMKRLGLSSDRIEKGRNFKVISEIQQDGQNFTWSQHYPGGHSISNNFTIGKETEMETVGNKKFKVTVKMEGGKVVVDSANYHHTVEIVDGKLVEVSTFGGVIYERVSKKVA

14.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FABP6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here